GenomeNet

>aaa:Acav_0058 glutathione S-transferase domain-containing protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MAGLFHCLQNLTMKLYYSPGACSLSPHIALHEAGLAFTPVLASTKSHKLQDGTDFYTINP
LGYVPVLELDDGTRLREGPAIVQYIADQAPHKNLAPANGTLARYRLQEWLNFIGTELHKG
HSPLFQANTPDAYKPIVREKLLSRFQWLDEQLAGKEWLMGEHFSVADGYLFTVSGWGKHV
GVDHSGLPNLQAYLARVGARPAVQAALKAEGLQK

BLAST