GenomeNet

>aac:Aaci_1648 DNA polymerase LigD, polymerase domain-containing protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MKRHESPPTLTHGDKIYFPAAGLCKRDYMTYLAQIGEHLVRHLRHRPVTLVRCPDGVAGR
RFYQRHLPPHAPPSLPRREVQGERPLIAIPDVETLLYYGNLGAIEFHAGLHLVQGPQAGC
PTALTFDLDPSDPRDFERVRELALCLREVLRGLGLDGVAKTTGASGLQVLVPLEEPLPYA
VTRPVVNFVAAYCASRWPDLATTERRVRHRGRRVYVDAPQHGPTRTLIAAYSVRAVEKAL
VSAPITWAELEYGVSPDAFDLHVVPDRLERVGDWLELAARHPASRVRAIHDALPPPWRQT
RVRSV

BLAST