GenomeNet

>aad:TC41_1544 lig; DNA polymerase LigD, polymerase domain-containing protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MKRMKRRETPPTLTHGDKIYFPGAGLNKRDYMTYLAQIGAHLVRHLRYRPVTLVRCPDGV
TGRRFYQRHLPPHAPPSLPRKEVQGERPLIAIPDVETLLYYGNLGAIEFHAGLHQSDGPQ
AGCPTALTFDLDPSDPNDFERVRELALRLREVLRELELDGLAKTTGASGLQVFVPLEQPL
PYAVTRPVVNFIAAYCASRWPDLATTERRVHQRGSRVYVDAPQHGPSRTLIAAYSVRAVE
KALVSVPITWDELAGGVSPDEFDLNVVPDRLARMGDLLGIAPRCPSSRVQAIHDALPPPW
RQTRVRSV

BLAST