GenomeNet

>aag:AaeL_AAEL009316 angiotensin-converting enzyme (dipeptidyl carboxypeptidase; K01283 peptidyl-dipeptidase A [EC:3.4.15.1] (A)
DPDLRRQLQYLTQISINHLPEQEFTALNNALGRMQHIYSSTLICPYDQQNCTTGTLSLDP
DLYEVMAESQDYDELLYAWKEWRDNTGRFMKNDYAEYVRLMNKAAGVAGFDDMGGLWRDA
FEQENFIDEMKRLWSQLKPFYLELHKYVRRELMQIYGDKMDSKNPNIPAHLLGNMWAQAW
GNLYNRIKPFKDTVDLDITKNLVEKGYTVKQLFEISNDFYVGLGLPDNSMSYNESLGAVI
EKPSDRVVTCHASAWDFCDRKDFRIKMCTRMNMEDFITIHHEMGHINYYLLYKDQPVTLR
AGANPGFHEAVGDTIALSVATPEHFRKIGLLDNYESSYENDINALFQKALDRVAFLPFGL
VIDMWRWEIFAAKVDFPNWNKRWWELREEYQMVSAPVERDLDAFDPGAKYHIPYDSQYIS
YFIAHILDLQLHKSLCQVAGEYDPNNSSKPLHKCDIDGSKEAGDRLRAGLSLGRSVHWSE
ALRAMTGETELKTDALLEYYAPLYEFLKKENEKADHGAGATIALSSVLVMLVTGVNLLSK
LL

BLAST