GenomeNet

>aag:AaeL_AAEL010608 succinate dehydrogenase; K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
SEMLRLPSLMAKSALSAARGLSAATSTQRGLHFTVGQNNAKTNPGAISKEYPVVDHTYDA
VVVGAGGAGLRAAFGLVAEGFKTAVITKLFPTRSHTVAAQGGINAALGNMEEDDWKWHMY
DTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTPDGKIYQRAFGGQSLKYGKGG
QAHRCCCVADRTGHSLLHTLYGQSLSYDCNYFIEYFALDLLMENGQCVGVIALNLEDGSI
HRFRSKNTVLATGGYGRAYFSCTSAHTCTGDGTAMVARAGLPSEDLEFVQFHPTGIYGAG
CLITEGCRGEGGYLINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCPEKDHVY
LQLHHLPPEQLAQRLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTNYKGQVLTVD
SSGNDHVVPGLYACGESACSSVHGANRLGANSLLDLVVFGRACAKTIAAENRPGEKIADI
KPNAGEASVANLDWVRNANGAVPTSTLRLNMQKTMQTHAAVFREEKTLQEGVRKMADIYK
TIKDVKVSDRSLVWNSDLVETLELQNLLLNANMTITAAENRKESRGAHAREDYKHRVDEY
DYSKPLEGQQKKPVEEHWRKHTLTWIDPETGAVKIDYRPVIDQTLSEECNTVPPAIRSY

BLAST