GenomeNet

>aag:AaeL_AAEL010807 hypothetical protein; K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] (A)
MNGTYDGKSTSSSSSSSSGGGGGGGGGGGGGGTSSSHSQHKAPRNYKLIVDPLIHKGGVP
KIYRYDGIVPGDPTYPPVIPRDPRNPLARLRSRIEPFVMIVPRFKIDEHYIGEPPAIEIT
ITNLNDNIDKPFLSDLLAKCGTYTELYIYYHPITNKHLGIARIVFENVRSARICVERLNG
TSVMGKVLNVFKDPFGEECKRLIEDKSSEKKKPAPPPPLPPVPVHKAAPMIPAKPHPPPM
PPASSSSSHYGGRNSSGTEFDMWDVDEYSGSAGNSRDSFSYGKDKYSSASKSGSQYESTR
EEDSRSRDKSRDKYYDRKDRDKPYFKDDRRDRERDRDRDRDYDRGRDRDRERERDRDRER
DRDRDRDRDRDRDREWDRDRTRDRDREWDSRERDRYGRDRDRRRSKSGAYGWYGESGSYS
SDMSYGSSRYSQYDYSYGYGASDYGTYGYPPPPSAIAGASSYAASSSSWAPPPPPEEKPK
APPPPPTAKPNFSGKSNLGGQSVLDDSDMWDLEESSETAPKPPSTPPGPPEPKTEPAAED
DNSGSALDLDTRIALMFKDKTFGGAPFLQLSDAEEEEKKEEGETGDESQDVPIKQEEVQV
KKEIKLEPPKEEMASDISSSEDDILAKESPPPAPAKPYMEDIIKRDNDQMSLSSLSSTDG
KNDDSKAPPLPADPVPDAPPPPEPTDSFAYVYPPGIGPGMGYPPAPPGTDPSYYYSQTYS
QASYQQYQSGYYQNSYMHPYMAGFTGAAYPYQKRDRYEDAIAAVIERVTAELKQILKKDF
NKKMIENTAYKKYEAWWDEEELKSKGKNKDILNDITPLAVAKVDKAPDINQLLNQNYDNL
DSNSSYIGLGLRATIPKMPSFRRIRKQPSPVPQDEDSRRSDQEDMVHGSDSEKETDFQPN
SSQTKAKTPPPSGSSATAVPVSRTSSASAVSRTEKRKPSVSSFFTSSSEEESSASESEDS
SESASLTDVEMSYTSRKQTPTSLRDKRDKRIYSDSDTDDDLDHPSSKFSLPSSSAGSRNK
AKIYSDSDSDEPSKPPRKEILPPVSTEKARSRSPEGFIPVGSKDRGTTPPPPPTTQLEPA
VSMLPLDQLHEDLSPDVDESPPTQQPPRTPGRESPKKSLYELDRIYSDSEEEREYQEKQR
RKAEYLEQIEREFQEEQARLAPAFKCCFCTTTNGNWQESSEKASQIKGQGRKEGERYQRS
TTTCCSRTRDSSSSCGTASNSAACYRPYHHDFATPSSEDFFSADEDAARRAAKASPASSD
GGSSQASQVALDHCYSLPPSASPSSSSPHPQSDSYAPVAKSANKYAPSSDVLAHDHGYTN
NDDIIGSAIPGTPGASIPMQEQDVIPSITMTPNASAQQSFIPVAKYYQRDIHSEMAILYD
FLTRGIDAEDIQYIKQSYELLLSDDANSYLLNATHWVDHCTTERSFVPPPAKKRKKDKES
VSDIKQHSTGSARTEGFYKIDPREKAKYKYHHLKGTAAANHLNNIEIAKAATKMQGLSRE
ARSNQRRLLTAFGASTESELLKFNQLKFRKKQLKFAKSAIHDWGLFAMEPIAADEMVIEY
VGQMVRPSVADLRETKYEAIGIGSSYLFRIDMETIIDATKCGNLARFINHSCNPNCYAKV
ITIESEKKIVIYSKQAIGINEEITYDYKFPLEDEKIPCLCGAQGCRGTLN

BLAST