GenomeNet

>aas:Aasi_1403 K02358 elongation factor Tu | (GenBank) hypothetical protein (A)
MAKETFDRSKPHVNIGTIGHVDHGKTTLTAAITKVLSKRGLAQVRDFGSIDNAPEERERG
ITINTSHVEYETSKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLASQVGVPNLVVFLNKVDAVDDPELVDLVEEEVRDLLKAYKFDGDNIPVIRGSALGALN
GEPEWEAKVEELMDNVDEYIPLPQRLIDRDFLMPVEDTMSITGRGTVATGRIERGVINVG
DPVQIIGMGAQNLNSTVTGVEMFRKLLDRGEAGDNVGLLLRGIDKEKIHRGMVICKPKSV
TPHRKFKAEVYVLSKEEGGRHTPFFNKYRPQFYFRTTDVTGEVKLPAGVEMVMPGDNIAL
EVELINEIAMEKGLRFAIREGGRTVGAGQIIEILD

BLAST