GenomeNet

>aau:AAur_0636 K01186 sialidase-1 [EC:3.2.1.18] | (GenBank) BNR/Asp-box repeat domain protein (A)
MARNTSSLHVVVSHPPARSSFERTSDLRSCSSPLARIAAVGTVSLGLLAGLGLPATAAPI
PPSNPAAAPGAFTEANIGADRTAANFFYRIPALTYLGNNVVLAAWDGRPGSAADAPNPNS
IVQRRSTDGGQTWGPVTVIAAGHVGDASGPKYGYSDPSYIYDAEAGKVLAFFVYSKDQGF
GGSQFGNNDADRTVISSAVIESSDGGVTWSQPRLITNVTKPGTSKTSPVAGDVRSNFASS
GEGIQLKYGQYKGRLIQQFAGDIRQTDGTNKIQAYSVYSDDHGATWHKGANVGDRMDENK
TVELSDGRVLLNSRDNANQGYRKVAISTDGGATYGPVTQDTELPDPANNGAIARMFPNAA
QGSADAKKLIFTNANSKTGRENVSARVSCDDGATWPGVRTIRSGFSAYSTVTRLENDKFG
VLYEGNYTDNMPFAKFDDAWLNYVCAPLAVPAVTTAPGATQQVPVTVTNQEAATLSGASA
TVYTPSGWSATTVPVPDVAPGASVTVNVALTAPANASGPQNLNAAFTTANGRVSQFTFTA
TVPAAPQVGLAITGTAPARDVVASPYQMGDVLSYSLNVKSTANVTANSVPVSGTFDSGFL
PPSAPNCRFNNLAAGASYTCTTAKHVITAADIQRGYFVPEASFSITASSTPSLTKTVPFT
GAAVALRDGLLTADISGARADVGRDLATQPYAAGDQVPYAFTVKNTSPLVEKVVPTAGNF
SPFLPEGPGNCRYSVLPAGQSYQCATPRHTVTAEEAEQGFFIPKTTWEVSSAGQSTKTIT
VDGGEVDLKVREPKLEGTVSAEWSDADGDRFASVGDPVTYTYTVGNAGNVAVTGLEAPDA
GISAATLPAGDTVTATRERVLTAADVAAGSLGAVSFEATAWNGSRAVAAAAGSDPLALAV
QPARPDSVPTLTVQELGTPPTDLGTADKYRTGQKVVLKGLEYGNWYYVYLNKTGYRLGWI
FPTTDNAVEFILPSDVKNGRDDAVVLDKDGGQVSFDRLQVTPKG

BLAST