GenomeNet

>aau:AAur_1905 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) ribulose bisphosphate carboxylase, large subunit,-like protein (A)
MYIPFMDGETMRDPRSVRCTYYLESEIDPAKAAAIMAGEQSSGTFMPVPGESARIRERHA
ARISDVQELGFCRPSLPSRATPEKVRAALVTVDFPMENIGTDLATLQTAIAGNLFELGEL
YACRLQDIALPEDFVAAHPGPAFGIEGTRKLISDVQGVMVGTIVKPNVGLSEEEFRLVVR
DLAMASIDLIKDDELMTDPAYLPLERRVAVATEEIRAAEQVTGHSTMYAFNITGDLAGLK
KRHDLVVEAGGRCVMLNIPVMGLPALALLRSFAEVPIHGHRAGLAASMRSKGLGMDYRVW
QQMARLAGADHLHASGLGSKFYELDEEVAANIRSLLEPLGQTTAPLPVLSSGQNVTTPGP
TFEAVGSTDLMMLAGGGVAAHPDGPGAGVRSLRQAWEAAVAGVPLQEAAQKRSHTGDDAL
LHAVQTFGKGA

BLAST