GenomeNet

>aau:AAur_1905 ribulose bisphosphate carboxylase, large subunit,-like protein; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MYIPFMDGETMRDPRSVRCTYYLESEIDPAKAAAIMAGEQSSGTFMPVPGESARIRERHA
ARISDVQELGFCRPSLPSRATPEKVRAALVTVDFPMENIGTDLATLQTAIAGNLFELGEL
YACRLQDIALPEDFVAAHPGPAFGIEGTRKLISDVQGVMVGTIVKPNVGLSEEEFRLVVR
DLAMASIDLIKDDELMTDPAYLPLERRVAVATEEIRAAEQVTGHSTMYAFNITGDLAGLK
KRHDLVVEAGGRCVMLNIPVMGLPALALLRSFAEVPIHGHRAGLAASMRSKGLGMDYRVW
QQMARLAGADHLHASGLGSKFYELDEEVAANIRSLLEPLGQTTAPLPVLSSGQNVTTPGP
TFEAVGSTDLMMLAGGGVAAHPDGPGAGVRSLRQAWEAAVAGVPLQEAAQKRSHTGDDAL
LHAVQTFGKGA

BLAST