GenomeNet

>aau:AAur_2048 no KO assigned | (GenBank) conserved hypothetical protein (A)
MAMASEATTVTVPGPDGPREVRISSPSRVMWPEAGLTKLDLATYLIDVGEAFVEANGNRP
ISLQRYSGNIEGEMFFSKNPPKGAPEYVRSVPVTYPSARSHPQLVIDEPAAAVWAAQMNT
VVFHPWASRANDPDNPDQLRIDLDPQPGTDFDDAIPAALELRTVLEEAGLTAFIKTSGNR
GLHVYAPIHPKHEFLDVRHAVIAAGRELERRMPEKVTTAWWKEERGTRIFVDFNQANRDR
TIAGAYSPRAVPTAQVSCPLTWDELENADPAKYTIKTVPDRLAKVGDPWASMHDHPGDID
VLLKWWERDVKNGQGEMPFPPEFPKMPGEPMRVQPSRARKPEE

BLAST