GenomeNet

>aau:AAur_3540 K01186 sialidase-1 [EC:3.2.1.18] | (GenBank) BNR/Asp-box repeat domain protein (A)
MTSYLLDSARPCIPSAVPDVEHVLAVRGMGGYRQYRIPALAVSMRGTVLAAYDGRPNLDD
LPNPIDLLLRRSYDHGVTWEPQQVVRRGSGLHGFGDPSLLVDAIIGRIFMFHAAGTHAGF
FEAVAGMEPDEDVQHADISFSDDDGDTWHHRRLTTQLKTGDITGLFAAAGQGIQIHSGPL
VGRLVQQYVLLVGGAIMAASAFSDDHGETWKLGNLIGPGTTGVGPNENKVVCLDDGRLLL
HSRATPSRLAAVSDDGGQTWSPLQPIPDLPDPSDNGSLTRFDGLPLIALAAPETSSWLLA
SNNQDPHLRRNTVLSLSPDNGATWPAKLTVCSGSSAYSTVTRLPNGNIGVLYERQGYREI
VFASIPAEQLVGQLSALQLTRPESSGLVFDMELRSITPGRPTVWQNAGDFHVIPSNSGGV
LDVQTWKEIGQGYAGDQVLGTREAQDLNYGPVIPGYKAGDILAFTGRVRNLGTDPATGVV
LLGPHNNASDFPPADLLPGEHVLYFTPTYTIAASDLEHGTLKLVFTAEADGGTVRLERTF
RFDLRSGTVAAS

BLAST