GenomeNet

>aav:Aave_0048 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) glutathione S-transferase, C-terminal domain protein (A)
MKLYYSPGACSLSPHIALHEAGLAFTPVLASTKSHKLQDGTDFYTINPLGYVPVLELDDG
TRLREGPAIVQYIADQAPHKNLAPANGTLARYRLQEWLNFIGTELHKGHSPLFQPNTPDA
YKPIVREKLMSRFQWVDEQLSGREWLTGEHFSVADGYLFTVSGWGKHVGVDLSGLPNLQA
YLARVGSRPAVQAALKAEGLQK

BLAST