GenomeNet

>aav:Aave_0048 glutathione S-transferase, C-terminal domain protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MKLYYSPGACSLSPHIALHEAGLAFTPVLASTKSHKLQDGTDFYTINPLGYVPVLELDDG
TRLREGPAIVQYIADQAPHKNLAPANGTLARYRLQEWLNFIGTELHKGHSPLFQPNTPDA
YKPIVREKLMSRFQWVDEQLSGREWLTGEHFSVADGYLFTVSGWGKHVGVDLSGLPNLQA
YLARVGSRPAVQAALKAEGLQK

BLAST