GenomeNet

>aav:Aave_2519 ATP-dependent DNA ligase LigD polymerase module / ATP-dependent DNA ligase LigD phosphoesterase module; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MARRSRTSGTAQEAPRKAPQKAPPDALADYARKRDFRNTPEPGAEPGDALPRGALRFVVQ
KHWASRLHYDFRLEIDGTMKSWAVPKGPSFDPRDKRMAVQVEDHPVAYNRFEGQIPARQY
GAGRVIIWDKGYWVPLEDPARAWRAGKLKFELHGHKLQGRWTLVRMHGRGNERQPPWLLI
KERDGLERDAVEYSVVDALPDSVKSLPDLPEPAPARGRQAPAPAASSPARRTAARGKAAA
SAPAPAPEPAAGRTARAGTSPRPKKAALPAALAPQLATLVDGPPTDLAEWMFELKFDGYR
ILARIEGGEVRLITRNGNDWTHRMPGLARAVRALPVESGWIDGEIVVPDRHGIPDFQALQ
NAFESGRRPGRSAAGSPDDGAVDRSGLVFYVFDLPFLNGHDLRGLPLAERRQALRTLVAE
AGSDTVRFSDAFEASPGELIASACRLGFEGVIGKRVSSAYGSGRSADWIKLKCGQRQEFV
IGGYTDPQGTRTGLGSLLLGVHGDDGQLHYAGNVGSGFSERTLTTLLGLLRSLAADRSPF
AEGTQVGRKAHWVKPQLLAEVAFAGWTQTRHVRQAVFRGLREDKPPREIVRETPAPAATV
AGPSPTPPAAPRPASSEATPSRARSTMTSRRTASAPSPASPPSSLRVTHGDRVIDAASGT
TKLDLVRYYALVAPLMMEHLRQRPVSVVRAPEGVGGELFFQKHPEHGSVDGVRTLDPALD
PGHPPLAEIAGPEGLPAWAQMNTIEFHSWNARSDRIDRPDRMAFDLDPGEGVPWDKVQEA
TTLMRVMLTELGLPGFLKTSGGKGLHVVVPIKRLYGWDAVKGFSQAVVQHMARTIPQLFV
AKSGPRNRVGKIFVDYLRNGFGATTVSAWSARARPGLGISVPLRWDELGALSSSTEWTVA
TVEDRLREGNAPWDGYAKAAVSITQAMKMLGYEPPRGGR

BLAST