GenomeNet

>abe:ARB_00299 K06067 histone deacetylase 1/2 [EC:3.5.1.98] | (RefSeq) hypothetical protein (A)
MTGFAPLDAPVTNGSTDKKRIAYFYDSDVGNYAYVAGHPMKPHRIRMTHSLVMNYGLYKK
MEIYRAKPASKFEMTQFHTDEYIDFLAKVTPDNMDQYAKEQSRYNVGDDCPVFDGLFEFC
GISAGGSMEGAARLNRNKCDIAVNWAGGLHHAKKSEASGFCYVNDIVLGILELLRFKQRV
LYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGELRDIGVGAGKYYSVNFPLRD
GIDDVSYKGIFEPVIKHVMEWYRPEAVVLQCGGDSLSGDRLGCFNLSMRGHANCVKYVKS
FNLPTLILGGGGYTMRNVARTWAYETGVLVGNQLPTELPYNDYYEVSFSDYPTLYAGCVL
TVFQYFSPDYELDVRPSNMDNANSKEYLEKIRMQVVENLRRTTFAPSVQMTDVPRDPLVD
GMDDEADAILDDLDEDENKDKRYTKRRFDNYVEKDGELSESEDEESAAANGVRRQPNRER
RRGNINYRHLDGDSIIDSGIVTPRDESSMPEEEPEQADKMDETENAEPPAKPSPAVEPLT
KPDSQMEDDETPVAETNGAAQEVEEKEPPVSTPASNLAVPHDNADGDTTMEDADVNMDET
IELEPPAEEQEEESAAKAPARETTPPKPPAAEETKSNASGAENTAAEPTQVTDTTEAKET
KLDTDESKEVPKEKE

BLAST