GenomeNet

>abe:ARB_03137 hypothetical protein; K02358 elongation factor Tu (A)
MSTLQRSLNVLLRTGKYAAQRPSAVNPMQYVFSHNRMSARGMAAAFERNKPHVNIGTIGH
VDHGKTTLTAAITKRQAEKGFANFLDYGSIDKAPEERKRGITISSAHIEYQTDKRHYAHV
DCPGHADYIKNMITGAASMDGAVVVVAASDGQMPQTREHLLLARQVGVQKLVVFVNKVDA
VEDPEMLELVELEMRELLSHYGFEGEETPIIFGSALCALESRRPELGVEKIDELLNAVDT
WIPTPERATDKPFLMSIEEVFSISGRGTVVSGRVERGILKKDSDVEIVGGSTTPIKTKVT
DIETFKKSCDESRAGDNSGLLLRGIKREDLKRGMVVAAPGSTKAHTDFMVSLYVLTEAEG
GRSNGFTHKYRPQMFIRTADEAASFSWPGEDQDKKAMPGDNVEMICKTLHPIAAEAGQRF
NIREGGRTVATGLITRVL

BLAST