GenomeNet

>abe:ARB_03137 K02358 elongation factor Tu | (RefSeq) hypothetical protein (A)
MSTLQRSLNVLLRTGKYAAQRPSAVNPMQYVFSHNRMSARGMAAAFERNKPHVNIGTIGH
VDHGKTTLTAAITKRQAEKGFANFLDYGSIDKAPEERKRGITISSAHIEYQTDKRHYAHV
DCPGHADYIKNMITGAASMDGAVVVVAASDGQMPQTREHLLLARQVGVQKLVVFVNKVDA
VEDPEMLELVELEMRELLSHYGFEGEETPIIFGSALCALESRRPELGVEKIDELLNAVDT
WIPTPERATDKPFLMSIEEVFSISGRGTVVSGRVERGILKKDSDVEIVGGSTTPIKTKVT
DIETFKKSCDESRAGDNSGLLLRGIKREDLKRGMVVAAPGSTKAHTDFMVSLYVLTEAEG
GRSNGFTHKYRPQMFIRTADEAASFSWPGEDQDKKAMPGDNVEMICKTLHPIAAEAGQRF
NIREGGRTVATGLITRVL

BLAST