GenomeNet

>abe:ARB_05100 hypothetical protein; K00844 hexokinase [EC:2.7.1.1] (A)
MGKGTLEQVALRLRQLFDSLLSVLQRLLRLSQKQKTTATTATTPSKTPSKTCEKRPSSLR
CRRSLDDLAADVQRQFTSHLSTARLAAMAAGIRLQLDRCAKSSPVCMLPSFNHALPSGCE
RGTFLALDVGGSTFRVALVELAGHGAMHIRRIASSAIDEPVKLLEGRAFFDWIALRILDM
LRAGDEGYGRDSSSPLPMGLSWSFPIDQTSIRSGLVLSMGKGFLCSNGTVGEDLGDLIMA
ACRKHQLNVRIEAIVNDSSATLLSRAYIDPSTRMSLILGTGTNVAIHYPTRAIGREKFGD
RPAAWFDKASHVIINTEMSMFGGGGVLPMTRWDDDLNRAHIKPDYQPLEYLVTGRYIGEI
VRLIVVEAVAVAGLFAGELPASLRLPYSLDTAIVACIEADTSSTLDKSAAMLTASHAFAV
APSTADMQFLQTVCKCVSRRGAAYLATAIYSLWRLSNESESPASSSPEHTRDDLLLTKGL
STTADLEIGQAVTIACDGTVINKYPGFRSTCQAYLNSLTSHANSNSNSSSNSTADSADSG
SDSATETESDKPMISLDPAPESGIFGAAVAVAVALPSSPSS

BLAST