GenomeNet

>abe:ARB_06804 K00693 glycogen synthase [EC:2.4.1.11] | (RefSeq) hypothetical protein (A)
MTERGIEIVYGRWLIEGAPRVLLIDTGAGYKYLDEWKGDLWNAAGIPSPSADSETNEAIA
FGYLVAWFLGELIFRQYICRDTERAVLAHFHEWLAGVALPLTKKRRMDVTTIFTTHATLL
GRYLCAGSVDFYNNLKNFDVDAEAGKRGIYHRYCIERAAAHSADVFTTVSHITAYESEHL
LKRKPDGVLPNGLNVKKFSAVHEFQNLHSHSKDKINDFVRGHFYGHNDFDLENTLYFFTS
GRYEYRNKGVDMFIESLARLNHRLKVSGSKTTVVAFIIMPSQTSSLTVEALKGQAVVKSL
RDTLESVEKSIGKRLFERCLGWKEGDNMPDEKDLMTNQDRVLIRRRLFAMKRHNLPPIVT
HNMLNDSEDPILNQLRRVQLFNYPTDRVKVVFHPEFLNSANPVLPLDYDDFVRGTNLGVF
PSYYEPWGYTPAECTVMGIPSITTNLAGFGCYMEELIENSADYGIYVVDRRLKGVDDSVN
QLTSYMFDFCQKSRRQRINQRNRTERLSDLLDWKRMGLEYVKARQLALRRAYPTSFDAAD
DFHEAIGHTEQKISRPLSVPGSPRDRTGTMTPGDFASIQEGREGLDTEDYISYKPPTSAN
GVNANTIPRAGSDDEEEDSIPVPIRPKRQSISLKLGPAPNGHGAGSETKAA

BLAST