GenomeNet

>aby:p3ABAYE0014 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) putative glutathione S-transferase family protein (EC:2.5.1.18) (A)
MITLHHLDQSRSFRILWLLEEIKQPYELKSYYRDSSTHLAPESLKNIHPLGKSPVLEWDG
KVIAESGAIVELLIQKLAPHLAPDMDEPTYVDYLQWIHFSESSAMLPFLLKTFNAIETKQ
GTKLVFLENYTQVEFDKVFGHLNEYLKDKEFLVADRLTGADFMMGFGLHALVYHMGQGEN
YPHIQRYVAGLSQLPSWQAAVQIEQNGVKSQK

BLAST