GenomeNet

>aca:ACP_1688 aldehyde dehydrogenase (NAD) family protein; K00128 aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] (A)
MATKSYQNLIGGRWVPARSGKTFLNVNPANHDDVVGEFALSGAEDVADAVEAAEEAYKTW
RLTPAPKRAEILYRTGELLTQRKEEYARAMTREMGKVLSETRGDVQEAIDTAFYMAGEGR
RLFGQTTPSELQNKFAMSVRMPVGVVGMIAPWNFPMAIPSWKLFPALVCGNTCVIKPAED
TPLSTIHLVETLIDAGLPAGVVNIVTGYGPEAGAPIVEHPGVRAVSFTGSSEVGRIVGQN
AAARFKPCSLEMGGKNAMIVLADANLDLALEGALWGAFGTTGQRCTATSRIIVDKAVAGE
FTARLVERAKSLRVGDGLDEAIQMGPQVNQQQIETSANYCAIAKAEGAELLCGGERLTGG
AHARGTFFAPTVVGRVKPGMRIAQEEVFGPVVSVIECDGFDDAVKIANGIQYGLSTALYS
RDVNLAFRAMRDLEAGITYINAPTIGAEVHLPFGGVKQTGNGHREGGTGALDFYTTWKSV
YVDYSDKLQRAQIDNAD

BLAST