GenomeNet

>aca:ACP_1688 K00128 aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] | (GenBank) aldehyde dehydrogenase (NAD) family protein (A)
MATKSYQNLIGGRWVPARSGKTFLNVNPANHDDVVGEFALSGAEDVADAVEAAEEAYKTW
RLTPAPKRAEILYRTGELLTQRKEEYARAMTREMGKVLSETRGDVQEAIDTAFYMAGEGR
RLFGQTTPSELQNKFAMSVRMPVGVVGMIAPWNFPMAIPSWKLFPALVCGNTCVIKPAED
TPLSTIHLVETLIDAGLPAGVVNIVTGYGPEAGAPIVEHPGVRAVSFTGSSEVGRIVGQN
AAARFKPCSLEMGGKNAMIVLADANLDLALEGALWGAFGTTGQRCTATSRIIVDKAVAGE
FTARLVERAKSLRVGDGLDEAIQMGPQVNQQQIETSANYCAIAKAEGAELLCGGERLTGG
AHARGTFFAPTVVGRVKPGMRIAQEEVFGPVVSVIECDGFDDAVKIANGIQYGLSTALYS
RDVNLAFRAMRDLEAGITYINAPTIGAEVHLPFGGVKQTGNGHREGGTGALDFYTTWKSV
YVDYSDKLQRAQIDNAD

BLAST