GenomeNet

>aca:ACP_3506 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) putative DNA ligase, ATP-dependent (A)
MRDFGVTPEPKGAAGKRLNAGALSFVVQKHAASHLHYDFRLEWQGVLKSWAVAKGPSYYP
GDKRLAVEVEDHPLAYGGFEGIIPQGQYGGGTVMLWDRGTWEPLGDAARQLRDGNLKFRL
HGEKLKGCWALVRMKGKFAGRSKPSWLLIKEHDESERGDDAPAIVDEAPLSVVSGRDMQQ
IAEAQDAVWNAKGAQAQSSAAAHRANAPKQSMPAALLPREIAATLKRLPSEALPRFVPPQ
LATLVSEPGAGENRVYEIKLDGYRIEARVDKKADPPVQLLTRTGLDWTSRMRPLADALLR
LPVQTALLDGELVVLEEKGTTSFAKLQAVLKDDSRHSLTYFAFDLLHLDGHNLRGEPLLI
RKKILSALLTDLPASSAVRFSEHVKGNGEEIFQKACKLGAEGVISKLAQGFYHSGRSRDW
WKLKCYLEQELVIGGYTLPSNGTYGVGALLLGYYDAGKLIYAGRTGTGFTRATHRRMREQ
LEAIRRGTAPFAKVEQDARRGAIWVQPQLVAQVSFASWTTDGLVRQAAFKGLREDKPAKT
VRREGGQMPESEGKAAKKPRANSTTVRSELRLTHRDKVLDKDSGLTKEALADYYARIAPF
MLPHIQGRAVSIVRCPAGSDLSCFFQKHNNHTLPGEIESIEIASRKTGKVEPFLTISSAN
DLLVLAQASVLEIHAWGSTRDSLEKPDRLTIDLDPDDAIDWKTLAGAAVEVRKRLARAGV
KSFLKSTGGKGLHVVAPIEPEHEWPEVKEFAHRMVLEMEKENPDLYLTRMTKAARKGKIY
LDYLRNERGATAIAPFSPRARPGAPVALPLRWSELKSAERPIFRVTEFDGWRKRLKADPW
RGFLQLHQSLRLPEAARVSPGGR

BLAST