GenomeNet

>acc:BDGL_000872 glutathione S-transferase, N-terminal domain protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MSHYCEKARWLLDHKELDYVAHNLIPGFHRAFAQLKTGQNLLPILKDDHQWIAESTKIAL
YLDDTYPEHSLLRRDEQLRQQTLKIDSLADELGIHVRRWALAHTLAQGDHALEIMMGEQG
YLRQFEKISKPFLKTLVKKNYKLEEELVNQSKERMDELINELNNCLIENQARYMVGDRLS
LADISVCSMLAPLLEIKGTPWEREEAEGVSEEWNNYQQNLLDLPLGQYVLRIYQTERNAR
VDWRGI

BLAST