GenomeNet

>ace:Acel_1670 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) DNA primase-like protein (A)
MADRRPGDLREYRRRRNFCRTPEPAGRADPRHITRNSAEPRFVVQRHRATRLHYDLRLEI
NGVLVSWAVPKGPTLDPTVRRAAIHVEDHPLEYLDFEGAIPHGEYGGGDVIVWDTGTWRP
HGTDDPAQAVVDGELHADFFGRKLRGRFVFVRRGTDEKSWLVLHKDDEHAVRGWNPEDYP
RSVLSGATNDDVARHPRRLWRGGRAHPVAQHNDTEASADEIAALDALDDEGTWEVFGRRL
KVTHLNKVIYPGRGRTHALTKRDLLRYAARIAPVVMPYLAGRPFTMHRFPDGIDAPGFWH
KQLPSHAPDWLPRWQNPSAKRGEAATYLVVDEPAALIWAVNFGAIEWHAWTSRTDRPDLP
TWALVDIDPGSRTTWRELVELALLHRDALDHLGVQGKPKLTGQRGIQIWIPIRRGPTFDD
TRAWVEHLSKVVGSLMPDAVSWEWEKKRRAGRARLDFTQNAANKTLVAPYSPRPLPRAPV
SAPVEWDELPHLRPDRFTVRTILDRLAERGDPFHALLTVNQQLPPLG

BLAST