GenomeNet

>ach:Achl_1787 DNA polymerase LigD, polymerase domain-containing protein (A)
MASEQTTITVPGPHGEREMRISSPSRVLFPDLGLTKLDLARYICEVGEAFIAANGDRPVS
LQRYSDNIDGEMFFSKNPPRGTPDFVRSVKVVYPSARSHPQLVLDEPAAAVWAVQMNTVV
FHPWPSRAENTDNPDQLRIDLDPQPGTDFDDAIPAAQVLRDVLAEAGLESFIKTSGNRGL
HVYAPIEPVREFLDVRHAVIAAAREVERRMPDKVTTAWWKEERGERIFLDFNQANRDRTI
AGAYSPRALPHAPVSCPITWDELETTDPRKFTVLTVPDRLKTVGDPWAGFGEKPGSIGTL
LEWWDRDIRDGLGEMPFPPDYPKMPGEPPRVQPSRAKKQD

BLAST