GenomeNet

>ach:Achl_3384 hypothetical protein; K01186 sialidase-1 [EC:3.2.1.18] (A)
MGQAAGIGALAVALLAGTGLPAQAAPIPSTSPTAPPGAFQETNLAADRTANNFFYRIPAL
SYLGNGVVLAAWDGRPGSAADAPNPNSIVQRRSTDGGRTWGPVQVIAAGHVGDAAAPKYG
YSDPSYVYDAEAGKVFAFFVYSKDQGFGGSQFGNDDADRNVISSAVIESSDGGTTWSQPR
LITGVTKPGTSKTNPVAGDVRSNFASSGEGIQLKYGPYKGRLIQQYAGDIRQADGSNRIQ
AYSVYSDDHGATWHKGANVGDRMDENKTVELSDGRVLLNSRDNANQGYRKVAVSTDGGAT
YGPVTQDTELPDPANNGAIARMFPNAAQGTADAKKLIFTNANSKTGRENVSARVSCDDGA
TWPGVRTIRSGFSAYSTVTRLDEGRLGVLYEANYTDNMPFAAFDDAWLNYACAPLSVPAV
TTAPGATKQVPVTVTNQEAATLSGATVTVYTPSGWSATTVPVPDVAPGASATVNVDLTAP
ANASGPQNLNAAFTTADGRVSQAAFTATVPVAPQVGLTITGAAPDRDVAASPYKAGDVVS
YTFNVKSTANVTANSVPLSGTFEAGFLPPAPGAPSSPNCRYNNLAAGASYTCTTARHTVT
AEDMARGYFVPQATFSITASATPSLTRTVAFTGAAVALRDGLVSATITGSRNDAGRDLAA
QPYTAGEAFPYKFDVTNTSPLVEKVVPTAGNFSPFVPDGPGNCRYNVLPAGQSYTCATPR
HTVTAEEAAQGFFIPETNWDVSAAGQTIRTYGVNGGEVDLKVRDASLDGTIAAEWTDKDG
DRYASAGDTVTYTYTVGNAGNVPLTGVAAPAAGISEPSLAAGSSVTATRDYVLTAADITA
GKLDAVSFSATGDNGTRRATASVSGGGIQLELQPAQPESEPALTVQDFDGQTPPFDLKTQ
DKYRNGQKVVLEGLDYGQWYYVYLNKRSQRIGWLFPTTANTVEFILPAGIQNGRDDVVVL
DKDGKQVSFDRLQVTPKG

BLAST