GenomeNet

>ack:C380_11440 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) RuBisCO-like protein (A)
MSPDRFEATYLIETPLDPAHVAEVLAGEQSCGTFTRVEGETDALRERARATVESIELLDV
ALVPSLPNGWMQRRGMFGTPQTWQRARLRVSFPCGNIGPNLPTLAATVSGNLFDLGEVTG
LRLESMKLPRAYREQFDMPRQGIAGTRALTGVQGRPLIGTIIKPNVGLSAEETGELAGRL
CAAGVDFIKDDEVCANPVHAPLADRVKSVMRRVRAHQDKTGKLVMVAFNITDETDAMRRH
ADLIAAEGGSCVMVSLNWCGYSAVQTLRRHTPLALHGHRNGYGALSRHPLLGFSFNAWQT
LWRLAGVDHMHVHGLQGKFSQTDEEVIESAHDTLAPLCEGLDDRVLPAFSNGQWAGTVPA
TWDSVHSNDLLFMSGGGILAHPDGAAAGVASLQQAWDAVQKNETLAERAAHAPELRRAIE
FFGKK

BLAST