GenomeNet

>acp:A2cp1_3973 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) glutathione S-transferase-like protein (A)
MPADMATEPAYELVYWPGLQGRGEFIRLAFEDAGVPYADLARLPDAGGGGAAAVMRLLEE
PGPWLTPLGPPALRHGEVVVAQTAAILQWLAPRIGLVPPDEASRLRAHQLQLTIADLVAE
VHAVHHPVATSLYYEDQRREAGRAAEAFRRERIPLFLRYLDRALDSNPAGGGRWLVGAGC
SYPDLSTFQVIEGLRYAFPRAMRRIERRFPRLVALHDAVAARPGVAAYLASDRRIPFNES
GIFRHYPELDEPAPKRSRPSTPGRRTAALRSGRAGKGERKPKIRGGAAPKKQRPTSRRRG
RSA

BLAST