GenomeNet

>acr:Acry_0813 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) Glutathione S-transferase, N-terminal domain protein (A)
MNDNSSVLYIGSRRYSSWSLRGWLAVRLAGLAVEERVIPLAGGHTPAVKAVSPSGMVPFL
EHEGARVWDSLAIIEYCAEIAPQIWPAARIARAHARAIAAEMHSGFRELRLAMPMNCTRT
LEPAEPAPAVRADLDRIEAIWAETRTRFGAGGPFLFGAALTGADAMYAPVVSRLLTYRPK
VTATTEAYLAAIRAHELVDAWYRDAAAEPDDWKIARYET

BLAST