GenomeNet

>acs:100551686 protein-glutamine gamma-glutamyltransferase 4-like; K05621 transglutaminase 4 [EC:2.3.2.13] (A)
MSETAVAPLEAIKIDFLSEYNAYFHHTEDFDNTNLIVRRGQEFKIDVTFSRELNDGDKVI
LQLSIGENPKRYNGTILYLNLTSNQKKQPWHAEIYQTDEEKCVIAVTSPPDAMVGKYRLD
LITGSNTHNFRDAVFYVLFNPWCEADSVFMPDEDQKAEYVLNDSGYLYGGSATHIFERPW
NFGQFEEDILDCCMRLLDLSLLGPHGQRNPIHIARAMSALVNYDENEDDDGVILGNWSGY
YEDGTSPEDWTGSVPILQQYYRNKEPVLYGQCWVFSGVLTTIMRCLGIPARSVTTYECAH
DHHRNINIDEIYNEMGEKMNISDFTWNYHVWNDIWMKRPDLPKGYDGWQVVDGTPQRGME
EMMECGPAPVIAIKKGEVYIPYDTMFVFSEVNADMVLWIIRNVNGKEEFMRVFEDTRTIG
RNISTKAVGKNEREDITDQYKFPEGSPEERKAMKTALSHANSLEDYTAASSRESPKAALT
LGIEEEKALVPGQPISLKIVVRSMSTNAWTINLCVSCHLESYTGKVQAGLKAVQQTVKTE
GKPIIQTPLVVDADMYMDIMSSTEDELLFKVNIFANVEDTHENLGKQITLTFQYPPLKVE
MPETAKVNESFTCEVIFENTLCIPLEKCKLCIEGLGIFPMTTFDQGNISPGQTSASKIVC
TARKFGKKKIVAKLNSIQVKGITEEKFITITENEEQQEDEESYVL

BLAST