GenomeNet

>acs:100551686 K05621 transglutaminase 4 [EC:2.3.2.13] | (RefSeq) protein-glutamine gamma-glutamyltransferase 4 (A)
MSETAVAPLEAIKIDFLSEYNAYFHHTEDFDNTNLIVRRGQEFKIDVTFSRELNDGDKVI
LQLSIGENPKRYNGTILYLNLTSNQKKQPWHAEIYQTDEEKCVIAVTSPPDAMVGKYRLD
LITGSNTHNFRDAVFYVLFNPWCEADSVFMPDEDQKAEYVLNDSGYLYGGSATHIFERPW
NFGQFEEDILDCCMRLLDLSLLGPHGQRNPIHIARAMSALVNYDENEDDDGVILGNWSGY
YEDGTSPEDWTGSVPILQQYYRNKEPVLYGQCWVFSGVLTTIMRCLGIPARSVTTYECAH
DHHRNINIDEIYNEMGEKMNISDFTWNYHVWNDIWMKRPDLPKGYDGWQVVDGTPQRGME
VTEMMECGPAPVIAIKKGEVYIPYDTMFVFSEVNADMVLWIIRNVNGKEEFMRVFEDTRT
IGRNISTKAVGKNEREDITDQYKFPEGSPEERKAMKTALSHANSLEDYTAASSRESPKAA
LTLGIEEEKALVPGQPISLKIVVRSMSTNAWTINLCVSCHLESYTGKVQAGLKAVQQTVK
TEGKPIIQTPLVVDADMYMDIMSSTEDELLFKVNIFANVEDTHENLGKQITLTFQYPPLK
VEMPETAKVNESFTCEVIFENTLCIPLEKCKLCIEGLGIFPMTTFDQGNISPGQTSASKI
VCTARKFGKKKIVAKLNSIQVKGITEEKFITITENEEQQEDEESYVL

BLAST