GenomeNet

>acs:100552410 uncharacterized LOC100552410; K00857 thymidine kinase [EC:2.7.1.21] (A)
MFENLTQAIGAVQQDLQKIANRQDQMDNKLAKLDKDQKSVKKRVERLEEQSQTYEDHHEQ
VLDAIAMQELKACECSLRIRGLKEGLERESLISFIANMLAGLLKEQDLDIIHASISSCFR
INSAFARQKKVPRDCIVQFVAKTFKEIVLKKQYETPIVIEGKKILMMKEIPGRLLRKRKE
FNALVVKLKNKGTPFRWLFPKGVSFYHKSKRHYITDAGKVEQFLRKYAQDFPGGEQQLAG
DESQGHRRGKGVPQERKERKQKEQEENEKACNEEKQRCHQGVESILKNTTNNSLEYQFCN
LTQIMFCPDEEQPMLPPAPLAALKADQVILAPGTGKHKQKKALICIEGNIASGKTTCLEY
FAKNTSIEVLTEPVSKWRNVCGHNPLSLMYQDATRWGITLQTYVQLTMLDQHMRTMVSPI
RMMERSIHSAKYIFVENLYRSGKMPEVDYVVLTEWFEWIIKNLSVSVDLIVYLQTSPERC
YERLKRRCREEEKVIPMEYLEAIHLLYEEWLIKKSLFKVPSPVLVLQADHDLQDMLEMYE
ENQDRILTPYNVQHCL

BLAST