GenomeNet

>acs:100552410 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) tk2; thymidine kinase 2, mitochondrial (A)
MRLLPWLRRPAPLLLRGLGLRMSSWLAKAQEGAGQDKYQANGGNKKTTICIEGNIASGKT
TCLEYFAKNTSIEVLTEPVSKWRNVCGHNPLSLMYQDATRWGITLQTYVQLTMLDQHMRT
MVSPIRMMERSIHSAKYIFVENLYRSGKMPEVDYVVLTEWFEWIIKNLSVSVDLIVYLQT
SPERCYERLKRRCREEEKVIPMEYLEAIHLLYEEWLIKKSLFKVPSPVLVLQADHDLQDM
LEMYEENQDRILTPYNVQHCL

BLAST