GenomeNet

>acs:100557793 protein-glutamine gamma-glutamyltransferase E; K05620 transglutaminase 3 [EC:2.3.2.13] (A)
MVNSNDDKGVLMGNWSGNYSGGENPGSWSGSVKILQQWKSSGFRPVRYGQCWVFAGVLTT
VLRCLGFPARMITNFNSAHDTNTNLRVDKYYSPDGSYLEYRTNDSVWNFHVWNEAWFTRS
DLGAKYNGWQILDATPQELSSNIFQCGPASLVAIKEGDVDLGYDCPFVFAEVNADEVTWI
LDKDTQSVKKAATDIRSVGKYLSTKAVGSFARLDVTDAYKYSEGSSEERETFQKARDKLN
MNLMAMPSMAGPAMAMPGMTISTIAMPVMDIPALLPDPPKPRVTGKFEVKSRPEVGQDVE
LVLQLTNLASAASTLTANMNAWTIVYTGKPIREVWKDSLALTLGPQEEKAFPIKISYADY
QKHLTTDNVIRATAVCQVKEGADTVVLKNISLENPTVTLKMPNQAKVGEVLKVEMVFTNP
LAEEISSCLLLAEGSDLLQDEIRKEVPPVKGKETVRVCFEVTPKKKGAKQLLANFSCDKF
KDIKAFQVITVVD

BLAST