GenomeNet

>acs:100558092 ace; angiotensin I converting enzyme; K01283 peptidyl-dipeptidase A [EC:3.4.15.1] (A)
MRSAPLYKPAPSLRPPFRTAKMPQLLALALLLLCCGAALALDASLLPPGSPAATEEGARL
FAQEYNATAETVFFDNTLASWVYNTNLTDFNAQLQVAASLMEQEFIEVWGKKTKEIYGNI
WQNFSDPELKKIISNIQTLGPSNLDLEKRQRYNTIMSEMDNIYSTSKVCLPNQTSNCWAL
EPDITDIMANSRSYSKLLYAWEGWHNSAGNPLRPKYEEFVSLSNEAYKMDGFKDTGAYWR
SSYDSPTFEDDLEELYHQLEPLYLNLHAFVRRKLYDRYGSKYINLKGPIPAHLLGNMWAQ
QWNNIYDMMIPFPNKPNVDVTNTMQQQNWNVTRMFRVSEEFFTSLGMLGMPPEFWEKSML
EKPTDGREVVCHASAWDFYNRKDFRIKQCTTITMEQLFTVHHEMGHVEYYLQYKDQPVTF
REGANPGFHEAIGDVMSLSVSTPAHLKKIGLLSEVTEDKESDINYLLKMALQKIAFIPFG
YLIDQWRWNVFSGRTTPSRYNYDWWYLRTKYQGICPPIARNETNFDPGAKYHIPGNTPYI
RYFVSYIVQFQFHKALCQAANHTGPLHTCDIYQSKEAGRLLSAALRPGSSQPWQDILQQI
TGTNKMDAAPLLEFFSPVISWLEEQNKQTNETLGWPDFEWRPPVPEGYPEGLDKITDEAE
AAKFLEEYNSTAEVVWNTYTEASWTYNVNITEHNKNIMLEKNLELSNHTLHYGLRARTFD
PTDFKDPSIKRILKKLSDIERAALSEQELKEYNQLLSDMETTYSVAKVCTGEKVCKSLDP
DLTKTMAQSRDYDELLEAWKGWRDVSGKKIRTPYKRYVQLSNKAARLNGHADNGAFWRSL
YETPAFEEDLERIWHQLQSLYFNLHAYVRRALYKKYGADHINLKGPIPAHLLGNMWAQSW
ANIFDLVAPFPNAIKVDATPAMKSKGWTPKKMFEESDNFFKSLGLIPMPDEFWKSSMLEK
PKDGREVVCHASAWDFYNRKDFRIKQCTVVNMDDLITTHHEMGHVQYFLQYKDQPISFRD
GANPGFHEAIGDVMALSVSTPKHLFSIKLLDQVEDNPESDINYLMSIALDKIAFLPFGYL
MDQWRWKVFDGRITEDEYNQQWWNLRLKYQGLCPPAPRSEDDFDPGAKFHIPANVPYVRY
FVSFVIQFQFHQALCKAAGHTGPLHKCDIYNSEAAGTILGNALKLGFSKPWPEVMQLITG
QPNMSADALLTYFQPLTDWLINQNLKNQETLGWPEYTWLPYAGQVQADNKVNFLGMLMTS
SEAAAGQWILLVLGLLLLIAAIVLGAKWHQARRRATRSSMEMELK

BLAST