GenomeNet

>acs:100559370 protein-glutamine gamma-glutamyltransferase E-like; K05624 transglutaminase 6 [EC:2.3.2.13] (A)
MAELTPTYMNWHGSSNGQAHRTSRFSASEPVFRRGQAFHITVYMSQATQGGEAFSFVAET
GQSPSESQGTRASFSASGVGGSWGASLEGREGNQLTFSLTSPASAPIGRWKLSLRVGQGD
ARLLGQFVLLFNPWCSADLVYLGDEDERQEYVLNENGIIFVGNAKYIEARGWFYGQFQKS
ILDLCLLLMDLSLYHRKDPGGDSSRRGDPRYVARVVSSMVNGNDNDNGVLEGKWSEEFAH
HENPSRWDGSVAILWKWAKDRYRPVQYGQCWVFAGVAATALRCLGIPTRLVTNFNSAHDS
DHNLAIDKYYDPSGKSLKIGQDSVWDYHVWNEGWFVRGDLGGSYSGWQVIDATPQERSQG
LYQCGPASVMAVKQGQVRLNYDTAFVYSEVNADINCWVVYPNGTRKRGHSDTTSIGVNMS
TKAVGSSARVDVTGNYKFPEGSSEERAVNRRALAELSGSHAAEEEVAEEASSRAGATAEE
GVPDTSPPSPASPSSDLISQPGLFGRFRLARPPVLGGDVALVLSLANLREEPTDVTVNLS
VATALYTRRTVREVLKEATTFRLQGKEERQLPLRITYGHYGAALTDDRKLLVTALCDVPG
GVKLLVEKAITLEGPDIRIKVPHRVVASVPTTVEIGYGNPLPVSVDQCVLLVTLMGHAVK
INVAALSPGEQSSIFFEFTPRSSGAMQLHVDFSCDRFQHVKAFTLMDVAEA

BLAST