GenomeNet

>acs:100563103 f13a1; coagulation factor XIII A chain; K03917 coagulation factor XIII A1 polypeptide [EC:2.3.2.13] (A)
MSMRICCHGDGEYPAFGARRGRGVPRQPKRQRGCRCTTEHLEAAIGLRALALSRPSRLCT
EVSPHSWLGVECIKSIGCLLGLSGSRCRYGTDVAKIQCFLSLCVFEDVLEVLEVRTFNRE
HEINKKEHHTDKYSNHKLIVRRGQPYHIQISFNRPYNPEKDTFWIEYLIGRYPQQAKGTY
IKVQLVEKLQSKEWGAKITHSDGQFVALNIMPAANCVVGKFRMYIAISTPIGILRTRRNP
ATDTYILFNPWCTEDLVYLDDEKQRQEYVLNDLGVIFYGDPENIRSRSWNYGQFEEGVLD
ACLYVMDRAELDLSGRWNPLKISRVGSAMINAKDDEGVIVGSWSNVYDYGVAPSAWTGSV
DILLEYHSSREPVRYGQCWVFAGVFNTFLRCLGIPARVVTNFCSAHDNDANLQMDVFVDE
NGKVDSKLTKDSIWNYHCWNEAWMSRPELPVGFGGWQAVDSTPQENSDGMYRCGPASVQA
IKHGHVCFPFDTPFVFAEVNSDVVYSKAMQNGVKLVQHVDKTQIGRLIVTKEEGTDKMKI
ITEQYKFQEGTEEERLALETALMYGVKKSIPQDVTSTLEVNMDFVVEDPTLGSDFNVTIT
FQNNTQSRYTATSYLSGNIVFYTGVSKNEFKNHSFNVTLEPMKAQTVEVLIKSSEYMSQL
LEQASLHFFVTARVNETQKILAQQKSVALKIPQLLLKVPGEKVVGKDMAVIVEFTNPLKE
DLNNVWVRLDGPGLLKPTSKLFREVPRNSTLTWEEKCLPKRAGLRKLIASLNCDALRHVY
GELDINIQSAV

BLAST