GenomeNet

>act:ACLA_039980 K17862 linoleate 10R-lipoxygenase [EC:1.13.11.62] | (RefSeq) animal haem peroxidase family protein (A)
MLRRFSSTFNKKKGDREPKQNGVATTTTTTTPTTNKRYSKVPEGHKSSSEEERNEKKGGA
VSPFEKYASVLHASRTPIPNQTGDGAYLEHEHTTSLLQDARHLGFKDLATLKEVIKNKAT
GQLVDDKTMLMERVIQLVSSLPHNSKHREELTHSFLDELWGSLPHPPLSYMGSEYAYRSA
DGSNNNPTLPWLGAANTAYARTIAPLIIQPGGLPDPGLVFDTLFARQSFKPHPNNVSSLF
FDWASLIIHDIFQTDYRNPHVNKTSGYLDLSILYGDVQEEQNLIRTFEGGRLKTDSFSEP
RLQAFPAACCVLLVMLNRFHNHVVEQLAAINENGRFTQPRDGLPEDQAKKAWEKYDEDLF
QTGRLITCGLYINITLYDYLRTIVNLNRTNSTWCLDPRAQMEGNNTTPSGLGNQCSVEFN
LAYRWHSAISANDEKWTEKIYEDLMGKPASEVSMTELLMGLGKYEAGLSKDPSQRTFAGL
ERQADGRFRDEDLVNILTGAIEDVAGSFGARNVPKVLKNVEVLGILQSRKWNVGSLNEFR
KFFGLKPYETFEEINSDPDVAESLRSLYDHPDFVELYPGIVSEEAKEPMIPGVGIAPTYT
ISRAVLSDAVALVRGDRYYTIDYNARNLTNWGYSEVRYDLSINQGCVFYKLATRAFPDWF
KSDSIYAHYPMTIPSENRKIMKNLGREAHYSYDRPQYIPPPVDLLSYPSAKLVAEQRKDF
HTVWADTVEFVFGKASKNFKLSEDTAFIERQRETISKLLSQDEWQRNVKEFYEEITTGLL
EEKTRRFAGINQVDITRDIGNLVPVIFASNLFSLPLRSKENSRGIFTEHEMFNVLAVLYN
CIYFDIDKTKSFPLHHASQAVGEQLGKAVEANVKSLGGSSLLSGILGGSRDNKNALKEYG
AHMTKQLLENGLGASEITWSQILPTVIAMVPSQAQAFTQIIDFYLSKEGSKYLPEIQRLA
REESKESDEQLLRYCMEAIRLNKTSGAYREARTSLTVTEETGQVTLQPGDKVFVGFAKAN
RDPSVFPDPSEVRLDRPLDAYINHSLGPHGFLSKETSQIALTAMLRAVGRLNNLRRAPGA
QGEVKKVPIADGYSAYLREDHGSYSVFPTTFRVHYDV

BLAST