GenomeNet

>act:ACLA_050720 K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2] | (RefSeq) alpha-ketoglutarate dehydrogenase complex subunit Kgd1, putative (A)
MFRNTAVKASSGMLRGSTSSTCRRSISLTATARTTASHSSKFGLTSRRPLAVVDRMCNGK
RFYAAGTSVGVDPNDNFLSGNTANYIDEMYLAWKKDPSSVHISWQTYFKNMEDGNMPISQ
AFQPPPTLVPTPTLGVPQDMPGAGLGLSAGTDVTSHLKVQLLVRAYQARGHHKAKIDPLG
IRGEAEAFGYNKPKELELDHYGFTERDLDQEFTLGPGILPRFATDSRKKMTLREIVATCE
KIYCGSYGVEYIHIPDRKPCDWIRDRFEIPEPYKYSVDDKRRILDRLIWSHSFESFLATK
FPNDKRFGLEGCETLVPGMKALIDRSVEHGIKDIVIGMPHRGRLNVLSNVVRKPNESIFS
EFSGSAEPSDEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKARSIQ
HYNNDETEFKTAMGVLLHGDAAFAAQGVVYETMGFHSLPAYSTGGTIHLIVNNQIGFTTD
PRFARSTPYCSDIAKSIDAPVFHVNADDVEALNYVCQVAADWRAEFKRDVVIDIVCYRKQ
GHNETDQPSFTQPLMYKRIAEQKAQLDKYVEKLISEGTFTKEDIDEHKKWVWGMLNDSFD
RSKDYQPTSKEWLTSAWNGFKTPKELATEVLPHLPTAAEPALLSRIAEKISGPPEGFTVH
RNLKRILANRRKTVEEGTGIDWPTAEALAFGTLVDEGYHVRVSGQDVERGTFSQRHAVLH
DQENEGTYTPLQDISDKQGSFVISNSSLSEFGALGFEYGYSLTSPNALVMWEAQFGDFAN
NAQCIIDQFIASGESKWLQRSGLVISLPHGYDGQGPEHSSGRMERWLQLCNEEPRVFPSQ
DKLDRQHQDCNMQIACMTSPANLFHILRRQIHRQFRKPLVIFFSKSLLRHPIARSDLEEF
TGESHFQWIIRDPAHGSAIDEPEKIERVILCSGQVYAALVKHREANNIRNTAITRVEQLH
PFPWAQLKENLDSYPNAKDIVWAQEEPLNAGAWSFAQPRLETLLNATEHHNRRHVLYAGR
APSASVATGLKSVHIKEEQEFLEDAFTLHQERLKGE

BLAST