GenomeNet

>act:ACLA_088100 SET domain protein; K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] (A)
MSRTSAGYADFFPTAPSVLQQRRIKAPRDHSLIKDRPGSEPKDGQLPSPENTIANISTNS
STLEFPITTIHTGQEKTQSRETGRINLDTTSTGSSILSSTLAQSSLAQLKELQIDTLTPL
TNAGSSPPQRSSPCQSKSAGGIAEYNKPSNFVTEEAKLVVTPLHTPPTPQSQTPRGGDIK
GSKLIYDPDIDKRSSKEKRRKPQYVDFVVSDPKSCPADPRLSISNYTRGAGCKQKTKYRP
APYRLKQWPYDASTTLGPGPPIQIVVTGFDPLTPIAPISALFSSFGEVSEINNRTDPITG
RFLGVCSVRYKDSNSFRGAESIPAATAARRAFLECKKEQRIGTRRIRVELDRDGAVSDKI
VAKTIESQRMGHRKNTVLEEAKLEPRLKRSEPPPTAPKGPSRSSTRPGLAIPEGPRASFV
KPAVPSLVEETPILSQIKREPYIFIAHCYVPVLSTTVPHLKKRLKLFDWKDIRCDKTGYY
IIFENSRRGEEETQRCFKVCHMKPLFTYIMNMESQPYGNPNYERSPSPERLQAERREKSE
RERVKREADLDIEEEKQQRAINMDPCREVLALIVRDLKDKLLEDVKSRIAAPALYDYLDP
ERHALKRQQLGLRDPEGIKKPAFRIDVEASLGPGQSRSVLSDGRHTFSPYGLNILALPRI
RKSHRLNSADAAFVDERRKQPMRKKEVRPLYHRLQQLHSVDDSDDESRTPFTVDPDEQDS
RPPSRMSSRSSDSDDGESAPEALDGFVSAQAKHGMDVLQTPVTEHTIDQYPHKDTPDSSL
TCKRKRPAEDVEARKRLKEDECEHLNRNLPAETALDLSTLRVDHDVLGSVDHIDDYQKHS
IQVSDKTIQAHEDHEQTSDGTPDIDSIIQNAGIEVKLQSPDEHDNAERHDGMRTEVEWGV
SNNEPRSTVDDDETIVMDLDGWQALVKDEEDLCFLRDVLSGLPWSKVDNLSAWAWRQKEI
KALSRPNETGPVHEEIKISGYYVCNFTGAARTEGRKRILESEKSKYLPHRIRVQKAREER
EAKARSDPHATAAEAARITAAKTISKSTSRSTRVNNRRLVADINAQKQALPMQSGDGDAL
RFNQLKKRKKPVRFARSAIHNWGLYAEENISANDMIIEYVGEKVRQQVADMRERQYLKSG
IGSSYLFRIDENTVIDATKRGGIARFINHSCTPNCTAKIIKVDGSKRIVIYALRDIERDE
ELTYDYKFEREWDSDDRIPCLCGSTGCKGFLN

BLAST