GenomeNet

>actn:L083_3658 K01186 sialidase-1 [EC:3.2.1.18] | (GenBank) glycoside hydrolase family protein (A)
MTLILRCLVALSLIVAGPSKGPQQHSETLLFDGGGETLNGTTYHSFRIPSLLRTTKDSLL
AFAEGRTESNRDHGNINLMVKRSTDDGATWSGLGQVVGTGQGTWGNPTAVVDRDTGTIFL
FVSWNAAGLSQDGADGTTRISAWGERRVRLFTSSKDEDGTVWHGPADLTEAVTPRKHADG
SDWAWDAVGPGAGIQTSSGRLLVPATNRTIYSDDHGKTFHSAPMARGQEVTGESTLLELT
DGRLMRNDTAVMSTWETAKNRWVARGTIEGGFDAYAPDPHLPDPHAEASILRYNLDTTPR
IIFLNSASSVNRRAMTIRVSTDEGVTWPVSRRLSDAPMPAWPQLGSANVVEGGYSSLAKT
ANKQVGALVEVNENADASDTSHRSIVFRTMNLPWITG

BLAST