GenomeNet

>actn:L083_7162 K05343 maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1] | (GenBank) malL; alpha amylase catalytic subunit (A)
MSDRWYEKAVIYCLDIDTYADSNGDGVGDIRGLIGRLDYLARLGITCLWLNPIHPSPDKD
DGYDVADFYNVDPRFGTLGDFAELLHQAQNRGIKVIIDLVVNHTSDQHPWFQSARQSPES
PYRDWYVWSETEPPDRNQGMVFPGEQKETWTYDRTAKQWFYHRFYKFQPDLNITNPQVRE
EIKKICAFWLQLGVAGFRMDAVPFIIEETEPGNPDAPKDFAFLTDLRQHIQWRRGDAVLL
AEANVEADQLKHFFGDQGGSANRIHMLFDFMLNGRLMLALARRHPEVIIDALQDTPKLPS
GAQWATFLRNHDEVDLSRLTAEQRAEVFGQFGPDESMQLYGRGIRRRLAPMLGGDRRRLE
LAYALQFSLRGTPVLRYGEEIGMGDDLSLEGRDAIRTPMQWSSLPNGGFSTATPDELIRP
VVTGGDFGYEQVNVTLQRHDPQSLLSWFERMIRTLRETPEVGSGTCKHVDIPVPAGVLVH
RADADTGCMVFIHNLGPDDGVVDLSSLEPEAEYPNDVLADQEYPDLGKMDALPIGGFGYR
WIRLKRFA

BLAST