GenomeNet

>adi:B5T_02554 Glutathione S-transferase family protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MMKLYDLEPSGNCYKVRLFAALAGLPLEIEAVDFLAGEHKGERLAALNPWGELPILEDGK
LVLRDSQAILVYLAGRYGGEAWWPGEAHLQGEVMQWLSVAANEIQHGPNAARLVDKFGYA
LDKALALERSERILRLLDDHLATHQWLAAGRPTIAECAVFPYLAVAWEGGVDPRPYQHVN
AWMERIKALPGFQPMPGV

BLAST