GenomeNet

>adi:B5T_02554 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) Glutathione S-transferase family protein (A)
MMKLYDLEPSGNCYKVRLFAALAGLPLEIEAVDFLAGEHKGERLAALNPWGELPILEDGK
LVLRDSQAILVYLAGRYGGEAWWPGEAHLQGEVMQWLSVAANEIQHGPNAARLVDKFGYA
LDKALALERSERILRLLDDHLATHQWLAAGRPTIAECAVFPYLAVAWEGGVDPRPYQHVN
AWMERIKALPGFQPMPGV

BLAST