GenomeNet

>aex:Astex_0787 glutathione s-transferase domain-containing protein; K04097 glutathione S-transferase [EC:2.5.1.18] (A)
MYDLYIANKNYSSWSLRPWVLLKTLNIPFTEHLHYFSTPIGENVQFKAFSPSSLVPALHD
QGLTIWDSLAIAEYVYEADPRVWPANREARAFARSAAAEMHSGFSVLRNICTMTCGLRVK
LHTISPALQRNIDRLDALFSEGLSRFGGPFLAGDTFTAVDAFYCPVAFRVQTYSLTLNPP
AQAYIERLLSLPAMQDWYAAALAETVREPEHEAEVTEAGVIEADYRAV

BLAST