GenomeNet

>afm:AFUA_5G02430 ATP dependent DNA ligase domain protein (EC:6.5.1.1); K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MDAPTVCLASFSFAQETSKILLIERNHPRGMWLPSCTNLSRVIGRCLLLGSDRRQELEQW
RVAGGADLGQCVENVMRQAEFDINSGQEVTVEEIDLALNKIASRCRFSGSRVRRQHSAVD
VEDTLRPLYRRMSSRDAKWLTRMILKSYHPVVLPAKLTMKSFHFLLPHLLLFQDSFDSAL
KMLASEPLCHYPPNPIPELAKDLCIQALQHLKPRIGIKIGRPEYHKARSIKHCCQMIGRR
RMSVERKYDGEYCQIHIDLTKRPNPIQIFSKSGKDSTDDRAGIHAVVKDSLSIGKSECKF
SRQCILEGELVVWNDNHGRIADFHKLRKFIARSGTYIGIDNDSPPQPYEHLMIVFFDILL
LDDDICLRKPHRERRLLLKNVVKVIDGYADIAEQHIVEFSHPSGRSRLETIFSKAVTERW
EGLVLKGCEDPYVSIFPGSENGSGGRWIKLKKDYIPGLGDTVDLTLIGARYDSRDAAALY
SSTKIFWTHFYIGCLVNKDAVLQSAAEPRFLVMDVIDCNSMSLKNMQILNQFGQFGACGL
DSGHGFRIEFGKDSLSDMNTVFKKPFVVEMLGGGFEKPSGARYFTLRFPRIQKIFLDRSF
EEAASYQELQLSAEEARMVPAEDLHHEEEWRRQLQQGQVSSYYIVTKSQTTSSGTSSCPM
TASSPSKGPSSEAIATTVIRTQPQHLSGDSIQQWNRVNDERVPADAISIFVDDSMATVSS
PESSEPPRKLLRSNDNLSSIQGSSKKRNQESSSNPSKGNSASYGEENGTTFPSNDSNASI
ELEACITLPLQPRKRRRLTENHASNVAPVVPSSCSNQPRCVKAPLTMIPLYFRQDLDRGD
STNTLIPPNSSNLAGDLQTFLQNQQYPKTLSGDFFSKSANRSQQPSNPTDIKLHEAARFS
SLMPNSSLSRQD

BLAST