GenomeNet

>afm:AFUA_5G06000 SET and WW domain protein; K11423 histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43] (A)
MSSHDNADSPSSSVANAVTAMKIEQHDGAADMLLSNGGDAVLKRDSNGLSEHAVTAKDYP
GMNDLASSTVKSRTSSLTPIKTENGDSTAKEEKVGGDITVKMEPGQPPKLSRSSSQKVVA
QPPQLFLHLPDSTAEAQSTFEVMETCTYANKYMGYTEHAMECDCAEEWEPSLSRNLACGE
DSDCINRATKIECVGDCSCGAECQNQRFQRKEYANVAVIKTEKKGFGLRAETDLRPHQFI
FEYVGEVINEAQFRRRMRQYDEEGIKHFYFMSLSRGEFVDATKKGNLGRFCNHSCNPNCY
VDKWVVGEKLRMGIFAERAIQAGEELVFNYNVDRYGADPQPCYCGEPNCTGFIGGKTQTD
RATKLSNATIEALGIEDADSWDTVVAKRPRKKKMGEDDEEYVDSVQPKSLDENGVTKVMA
ALMQCKEKWIAVKLLRRIERCDDDRVRHRVVKMHGYQILNSQLTLWKDDFNVVLQILNIL
DGFPRLTRNKIIDSKIESTVQPLTTCGDERVEKKAAALLQHWATLEVGYRIPRMKRDPNA
VASVSQFGRREHTTDEQKRSQSRSRSRSPSLDAPRGPANPGRKSNGPRNSQHHGARQFRR
QFNPLPPGWFAAESHGRTYYYCARGDVTWTRPIHAAPEAEVPGQQAKNKALQGIIDNILN
AKENTPKEKTVTPGTPQASRETASLNEGQERWRSYSEEKQKKLYENTLFPHIKYVVDKFK
HKLPKEDLKRYAKDVAKKLVNSDFKNNRVEDPTKISEKQQKKVKAFCKEFFDKAVAKHRA
YEQRKAEKQAKGGNSKADDMISGHNTVEDDVKLSDGEAEKVEENDNSMSSDPQGILKRKR
EDEMDIGEGAAEEAMKRQKSSTPIPPPPPPPPPLGDEEQPTPNGTGEDDFLAENGVSMLH
SPGSAPTPPPPPPLSTEHSDNDEMGQSPSMSNHLLEQKSFPAPLGEEYEADSGKLSSNRI
GIEGQV

BLAST