GenomeNet

>afm:AFUA_6G03390 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) glutathione S-transferase family protein (EC:2.5.1.18) (A)
MASFYAAETPERVKKAQLTLTKGLHLITSLTPNGRKVHILLEELKDTYGLEWMISLIDLD
KNEQKKDWFLRLNPNGRIPILIDNNTCPPHVVMKSSAELLYLVNLADKDNIFWFLDLIDK
CNIIFLGIMRTKALTVASENCCRCTTYLKSVFQGDMVAAHGSIWLGRVRANTALLISMPG
PGCEIFDALDSRRMSWLRYLIYNSGWIALRRDQLWSEVWGSGMMRMCIQSYCLRLRDYLL
RCA

BLAST