GenomeNet

>afr:AFE_2155 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) cbbL2; ribulose bisphosphate carboxylase, large subunit 2 (EC:4.1.1.39) (A)
MDQSNRYADLSLKEEDLISGGKHILVAYKMKPKAGHGYLEAAAHFAAESSTGTNVEVSTT
DDFTKGVDALVYHIDEATEDMRIAFPLELFDRNVTDGRMMIVSFLTLVIGNNQGMGDIEH
GQMIDFFMPPRAIQLFDGPAKDISDLWRILGRPIKDGGYIAGTIIKPKLGLRPEPFAAAA
YQFWLGGDFIKNDEPQGNQVFAPVKKTIPLVYDAMKRAMDETGEAKLFSMNITADDHYEM
CARADFALETFGPDADKLAFLVDGFVGGPGMITTARRQYAGQYLHYHRAGHGMITSPSAK
RGYTAFVLAKMSRLQGASGIHVGTMGYGKMEGGADDRNIAYMIERDSCDGPVYHQEWYGM
KPTTPIISGGMNALRLPGFFENLGHGNVINTAGGGSYGHIDSPAAGAVSLRQAYECWKAG
ADPIEYAREHKEFARAFESFPGDADKLYPGWREKLGVHR

BLAST