GenomeNet

>afr:AFE_3052 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) cbbS-1; ribulose bisphosphate carboxylase, small subunit (A)
MSEVQDYKSRLSDPASRKFETLSYLPALTAEQIRQQVAYIVSKGWNPAVEHTEPENAFGN
YWYMWKLPMFGETDVDTILKEAEACHKANPHNHVRIVGYDNFKQSQGTSLVVYRGKTV

BLAST