GenomeNet

>afr:AFE_3052 cbbS-1; ribulose bisphosphate carboxylase, small subunit (EC:4.1.1.39); K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MSEVQDYKSRLSDPASRKFETLSYLPALTAEQIRQQVAYIVSKGWNPAVEHTEPENAFGN
YWYMWKLPMFGETDVDTILKEAEACHKANPHNHVRIVGYDNFKQSQGTSLVVYRGKTV

BLAST