GenomeNet

>afv:AFLA_084130 K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2] | (RefSeq) alpha-ketoglutarate dehydrogenase complex subunit Kgd1, putative (A)
MPFWPLHRATKEEIVHNDDFLQGSAATYIDMMYSSWKNDPSSVHLSWQAYFHNVENGHIP
MDQAFMPPPGLVTASTRTSIAPSSREDSSTVKQLKVIQLIQAYQRWGHEHASTDPLGMAN
EGKIRRKELQLSRYGLSEQDLDLVLTVGTGSVQDFTSEKPKLLWEVIAACEKTYCSTMGI
EYNISNQEQVDWIRARIEGAQRHRFTDEEKRRMLHGLVRATSWEKFVATKFPNEKRFGLD
GVESYIPALETAIDRSAEHGVDKTEMGVAHRGRMNMLYNIVGKDGASMFRDFDPKGTSSW
GIPGDIKYHYGGSGERVTPSGKKVYMNVLPQPSHLDSVNPVAMGKTRGIQDRLADEREST
MMLNVHTDASFAAQGTIYETLGLSGLPGYTTGGTLRVIVNNQVGFTTDMWLRCWMHQYST
SMETMSKRFARRRFLQLISAHDSRKIVWSILFAIGATDTMRWTRLLSLSLLCTSGLPIRP
IS

BLAST