GenomeNet

>aga:AgaP_AGAP005627 K00933 creatine kinase [EC:2.7.3.2] | (RefSeq) AGAP005627-PD (A)
MVDAAVMEKMEAGFAKLAASDSKSLLKKYLTKEVFDALKNKKTSFGSTLLDCVQSGFENP
DSGVGIYAPDAEAYSLFADLFDPIIEDYHKGFKKTDKHPASDFGDVNAFGNVDPTGEFVV
STRVRCGRSMEGYPFNPCLTEAQYKEMEGKVSTTLSGLEGELKGKFYPLTGMDKAVQQQL
IDDHFLFKEGDRFLQAANACRYWPSGRGIYHNDNKTFLVWCNEEDHLRIISMQMGGDLGQ
VYRRLVTAVNDIEKRIPFSHHDRLGFLTFCPTNLGTTIRASVHIKVPKLAKDYAKLEATA
DKYNLQVRGTRGEHSEAEGGIYDISNKRRMGLTEFQAVKEMYDGISEIIKIEKSL

BLAST