GenomeNet

>ahe:Arch_0266 K00112 glycerol-3-phosphate dehydrogenase subunit B [EC:1.1.5.3] | (GenBank) glycerol-3-phosphate dehydrogenase, anaerobic, B subunit (A)
MKIVVVGAGLAGLSAAMMLTEAGHRVEIVSKGIGGLLLSTGGLDVAGWNADGTPVSQPFE
AVESYAGSEHPYAKIGAESVRKGIGWLSSRTPAFHFPAGDETNALIPTPVGAVRPMLGLH
STMVGLENGQKIAVVGIKQFKDFPAQFIADNLSRSPYVDVQARAVEISMNIRSHEADSAG
TNIARFLDTSEGQTAFVDALRGKVEPDEIVLLPAVLGLDPRTFGVLSDALGVRLSEVPVA
PPSIPGRRINDALVAAAKASRVDLSNNAQVIGCEHENGRITAVHIQRAGRVTVSKVDAVI
HAGGGFESGSLTRSPEGDIRERAFDLPVRETADIFASGVRVDASMHPVDESGAVVFQNMY
LAGSIIGGSHAPVEKSGEGIALGSAWAAAHAAMSEGENR

BLAST