GenomeNet

>ahe:Arch_0266 glycerol-3-phosphate dehydrogenase; K00112 glycerol-3-phosphate dehydrogenase subunit B [EC:1.1.5.3] (A)
MKIVVVGAGLAGLSAAMMLTEAGHRVEIVSKGIGGLLLSTGGLDVAGWNADGTPVSQPFE
AVESYAGSEHPYAKIGAESVRKGIGWLSSRTPAFHFPAGDETNALIPTPVGAVRPMLGLH
STMVGLENGQKIAVVGIKQFKDFPAQFIADNLSRSPYVDVQARAVEISMNIRSHEADSAG
TNIARFLDTSEGQTAFVDALRGKVEPDEIVLLPAVLGLDPRTFGVLSDALGVRLSEVPVA
PPSIPGRRINDALVAAAKASRVDLSNNAQVIGCEHENGRITAVHIQRAGRVTVSKVDAVI
HAGGGFESGSLTRSPEGDIRERAFDLPVRETADIFASGVRVDASMHPVDESGAVVFQNMY
LAGSIIGGSHAPVEKSGEGIALGSAWAAAHAAMSEGENR

BLAST