GenomeNet

>ahe:Arch_1299 K01186 sialidase-1 [EC:3.2.1.18] | (GenBank) LPXTG-motif cell wall anchor domain protein (A)
MRKFTSRLVAGIATMGLLIAPALPASASSEVINKRTLVNHAKTVGDAGTAYLAVDNGPED
DVVRVGETISFESRFQSGLSEIVYVKATSEALGDTQADKCSWRGVPYNSGAQLRQIPAKD
GYWCVQKPSYKVKEADLEHPTKTFDITYNVYKDANASGKPFSTLTVKKTVKIQKAIENPG
EKDGPKDVLLAKANDFDFPVHRIPALAKAPNGNLLAAWDGRPAVYSNNDSPNPNTILLRI
SKDNGETWEPVQKIASGQLRDKASGKKQIGYSDPSFVVDNVSGKVFAFFVKSYDQGIAGS
RSGVDPEDPNVIHAVYVVSENNGESWSAPKDVTGILAEGYKQHARFATSGAGIQLKYGDH
PGRLIQQYLVVNNGQDGNWGSGEHQAVSLYSDDNGKTWHSGKPVGTTMDENKVVELSDGK
VLLSSRQFHHRGGRHYAISSDGGINYQMDYTNDNRLADPQNNASIIRAFPEAKKGSALAK
VLLSSHANSRKHYDRVNGTISYSLDDGATWTNGSVFKPGKMQYSVMTALGNDAYGILYEG
NDSTIVYKKVDLNWISPELAKYAEDHKADLGNADSEAAEKIKKLEDEIADLKAKLEAANQ
AKDEAEKAAKKAEEEKRDADREKVKAETAKREVEAKLKKAEGDKADLEKRVAELEGDIAK
AEEAKKAADKAVEEANAAKKKAEEEAAELKAKNAELEKKLKEAGKAEIPLVPLTPAEPTP
APEPQPAPAISMVSDKVAVGSQVVFTGTGFTPDAKVKVAVHSTAVELGEYVADKDGKITV
TWTVPAGFELGAHKVIFTAGDKTVEKSFTVVAPEKPVPTKPAAPGLAKTGVTLGLVAGLA
TLSIMAGVVAVRRRHEV

BLAST