GenomeNet

>ahe:Arch_1345 K00886 polyphosphate glucokinase [EC:2.7.1.63] | (GenBank) ROK family protein (A)
MTAGSHKHAPDPNSKLNTLSLDFGGSRVKSAVLDPDGTQLGTHIVDFVGYPFTPDALIAT
VNTHTNAHSIPFQRITIGMPGIIRNGRVIHTPHYIRTTGPGGTVDPELVSAWTGADVKGL
VETTTRLPALVVNDAIVTAAGVITGNGSELVLTFGTGLGVAFAVDGTLTEHIEVSHAPSP
LGGTFDDTVGAINVSGADPALWSENILRVIDSLWPMYRWDQLYVGGGNAFKLTAPVRARL
ADAGVKFLDYEAGARGGAAAWEHVK

BLAST